SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00034582001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00034582001
Domain Number 1 Region: 516-592
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.00000000167
Family Reverse transcriptase 0.01
Further Details:      
 
Domain Number 2 Region: 128-162
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000942
Family Retrovirus zinc finger-like domains 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00034582001
Sequence length 821
Comment (Vitis vinifera)
Sequence
MLRSDCNQSFWKEKFISGLPKLFSERIRIKIREQYNGQIPYDKLTYGEIISIVTAEGIKL
CNDFKLKQQMKNEQKIYKNEFGSFCSQFGFSQKETMPPSKQKPSRKPSKDKMNDTKQSRH
VQRRVNKDTQKKVETPLDVKPIICFKCGKVGHYKKDCRVKQKINNLSVSDDLKNMLCKVI
LNSSDSESRTDSDNEDDINQLDSSDDVSSQSSSDQDVCIKGNCNCRPKTINVISQDQEFI
LDTLRKVEDEKTKQNLYEVFKKYVVKVEAKKTVNPYNLHDILNRFDQQSPKDVSIKELHE
EVKQHKKEIKELRQFIKIHMDIPESSHVNDNETDTFLNTVSRVIFQRWEVSLTIVVKDKF
VFDIIALIDSGAAENCLQEGICIKQTFILVKDLKEKVLLGVPFLSSIFPMWVDDQGIRTK
LLDKESLFEFANPPGERSINTIKDQVIKAKQNHINLLKQEIALVRIEDQLKVKKTQDAIE
SLKNKIIKEVCSNIPNAFWHRKQHEVELPYEPDFSEKNIPTKARPIQMNKDLLGYCEKEI
QDLMDKKLIRKSKSPWSCSAFYVQKQAELERGTPRLVINHKPLNDEFQENPQVNQAFVDR
INQKIKDNLVTPLTVQPDKRINMVKGDISSEEEADELIKMFEEPHNQIINNLEAFKTRNY
YPMPTFPDMQFEERNQYTQSSYTSGTIYEWNIDGMTEYNILTKLQEMTMVSTAYKLNNRL
PDHAVAQTIVAGFTGQLKGWWDNYLTFDDRNSILKAYRINESNEVVKDEDGQDIEDAVAT
LIYSISKHFIGDPAKIKDKTADLLTNLKCPKLHDFWWYKSS
Download sequence
Identical sequences 29760.GSVIVG00034582001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]