SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00034929001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00034929001
Domain Number 1 Region: 341-516
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1e-22
Family Reverse transcriptase 0.0073
Further Details:      
 
Weak hits

Sequence:  29760.GSVIVG00034929001
Domain Number - Region: 246-264
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000488
Family Retrovirus zinc finger-like domains 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00034929001
Sequence length 519
Comment (Vitis vinifera)
Sequence
MVSTTYKLNNRLSDHVVAQTIVAGFTGQLKGWWDNYLTFEDRNGILKAYRINEENEVVKD
EDGQDIEDAVATLIYSISKHFIGDPTKIKDKIVNLLTNLKCPKLHDSGWYREVFLTKVML
RSDCNQSFWKEKFISGLPRLFSERIRIKIREQFNGKIPYDKLTYGEIISIVTLEGIKLCN
DFKLKQQMKNEKRIYKNEFGSFCSQFGFNQKETKPPSKQRKKKVGRKPSKEKRMNKEAQK
KLEAPSQAKPVCFKCGKEGHYKKDYRVKQKIDNLNFVEDLKDMLCKVMLNSTESKSRTDS
DNEDDINQLDSSGEEILSQTSICSNIPDAYWYRKLYEVELPYELDFSERNIPTKARPIQI
NKDLLSYCDKEIQDLLDKKLIRKSKSPWSCLAFYVKKQAELERGTPRLVINYKLFNDVLS
WIRCPIPNKTTFVVPRGHYEWFIMPFDLKNAPSEFQNIMGFKVKTLPCLAFMVIGNDTPD
IGYGGILKQSFGNHELLVRFTLGTWNTTQLIHNIIKKEI
Download sequence
Identical sequences 29760.GSVIVG00034929001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]