SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00035738001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00035738001
Domain Number 1 Region: 1-177
Classification Level Classification E-value
Superfamily Cyclophilin-like 1.39e-53
Family Cyclophilin (peptidylprolyl isomerase) 0.0000298
Further Details:      
 
Domain Number 2 Region: 229-338
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.97e-27
Family Canonical RBD 0.0033
Further Details:      
 
Domain Number 3 Region: 327-363
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000523
Family Retrovirus zinc finger-like domains 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00035738001
Sequence length 627
Comment (Vitis vinifera)
Sequence
MSVLIVTSLGDIVVDLYTDRCPLTSKNFLKLCKIKYYNGCLFHMVQKDFTAQTGDPTATG
TGGDSIYKFLYGDQARFFNDEVHLDLKHSKTGTVAMASAGENLNASQFYFTLRDDLDYLD
GKHTVFGEVAEGLETLTRINEAYVDDKGRPYKNIRIKHTYILDDPFGDPSQLTELIPDAS
PEGKPKDEVDDDVRLEDDWVPLDEQLDTSELEELIRSKEAHSRAVVLESIGDIPDAEIKP
PDNVLFVCKLNPVTEDEDLHTIFSRFGTVISAEIIRDFKTGDSLCYAFIEFETNEACEQA
YFKMDNALIDDRRIHVDFSQSVSKLWSQYRRRDHQTGKGTGCFKCGAVDHIAKDCTGSPT
KQQQPPKYILKDNNTQHGGDNNSRYEMVFDEDTSESPKREKRRQDHGPEDQIEKEKLNRR
GSEDWKRRDHDKKDSDDRHRQSDKGQESRASRLSGSRRDPYHHEERIDREKHRERQDEGK
RERDERDYRKRNADSDSHRERRDGRDERHHRKRNADGDRHVDRRDVGDYRKRDTDDDDHG
DGRDGRDYRKRSADNDGRGDRRDDRDHRKTKADEDRRDKRDMRDEPSYRKRSADGDGNGG
RREERGHKRHSTESNDDRDRRHRGDRR
Download sequence
Identical sequences XP_002266085.2.54126 29760.GSVIVG00035738001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]