SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00035958001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00035958001
Domain Number 1 Region: 191-237
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000000183
Family Retrovirus zinc finger-like domains 0.0023
Further Details:      
 
Domain Number 2 Region: 120-161
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000000462
Family Retrovirus zinc finger-like domains 0.0019
Further Details:      
 
Domain Number 3 Region: 79-116
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000000764
Family Retrovirus zinc finger-like domains 0.0016
Further Details:      
 
Domain Number 4 Region: 34-78
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000188
Family Retrovirus zinc finger-like domains 0.0029
Further Details:      
 
Weak hits

Sequence:  29760.GSVIVG00035958001
Domain Number - Region: 160-180
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000136
Family Retrovirus zinc finger-like domains 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00035958001
Sequence length 246
Comment (Vitis vinifera)
Sequence
MSSGSQSRSRSPQDRKIRTDRLSYRNAPYRRDSRRGFSQGNLCKNCKRPGHYARECPNVA
VCHNCSLPGHIASECTTRSLCWNCQEPGHTASNCPNEGICHTCGKTGHLARDCSAPPVPP
GDLRLCNNCYKQGHIAADCTNDKACNNCRKTGHLARDCRNDPVCNLCNVSGHVARQCPKA
NVLGDRGGGPRSSGFRDIVCRNCQQLGHMSRDCAAPLMICRNCGGRGHMAFECPSGRFMD
RFPRRY
Download sequence
Identical sequences 29760.GSVIVG00035958001 XP_003631583.1.54126 XP_010647662.1.54126 XP_010647664.1.54126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]