SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29760.GSVIVG00037749001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29760.GSVIVG00037749001
Domain Number 1 Region: 503-543
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000314
Family Retrovirus zinc finger-like domains 0.0018
Further Details:      
 
Weak hits

Sequence:  29760.GSVIVG00037749001
Domain Number - Region: 754-788
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0253
Family Retroviral integrase, catalytic domain 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 29760.GSVIVG00037749001
Sequence length 788
Comment (Vitis vinifera)
Sequence
MMISLNAKSKLGFIDGTTIMPSVTDKPDEHASWKKCNDMILSWILNSLSQDLADSVIFST
TAQEVWEDLRDRFSQSNAPRVFHIERDIACLTQDQMTKVKKLVKSDFFRLFNHKNQTAQE
LFADNYSKLHEDSKKWLEETSKNCTIVAVLIATVAFAAAYTVPGGNQQSSGIPKVKELVK
SDFVRLFNHKNQTAEELLVDNYSKLHEESKEWTKRTSENCSIVGVLIATVAFAAAYTVPG
GNQSTEYEMFAKRLLTATDNEGNSLLHMVGKKRKSQASEKMQSPALQLRNEMFLFEFDGT
DFAYWRMQIEDYLYGRKLHLPLLGTKPESMKAEEWALLDRQVLGVIRLTLSRSVAHNVVK
EKTIADLMKALSGMYEKPSANNKVHLMMKLFNLKMAENASVAQHLNEFNTITNQLSSVEI
DFDDEIRALIVLASLPNSWEAMRMAVSNSTGKEKLKYNDIRDLILAEEIRRRDAGETSGS
GSALNLETRGRGNNRNSNQGRSNSRNSNRNISKSRSGQQVQCWNCGKTGHFKRQCKSPKK
KNEDDSANAVTEEVQDALLLAVDSPLDDWVLDSGASFHTTPHREIIQNYVAGDFGKVYLA
DGSALDVVGLGDVRISLPNGSVWLLEKVRHIPDLRRNLISVGQLDDEGHAILFVGGTWKV
TKGARVLARGKKTGTLYMTSCPRDTIAVADASTDTSLWHRRLGHMSEKGMKMLLSKGKLL
ELKSIDFDMCESCILGKQKKVSFLKTGRTLKAEKLELVHTDLWGPSPVASLGGSRYYITF
IDDSSRKV
Download sequence
Identical sequences 29760.GSVIVG00037749001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]