SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 298386.PBPRA1424 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  298386.PBPRA1424
Domain Number 1 Region: 4-120
Classification Level Classification E-value
Superfamily SpoIIaa-like 3.1e-21
Family Sfri0576-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 298386.PBPRA1424
Sequence length 121
Comment (Photobacterium profundum SS9)
Sequence
MFEITQCGDNRIDMSFGGKLDSEEMKALLDEFVDKTKDVENGTMLYTIHEFDFPTLSAIG
VELTRLPELFRHTRKFKKVAVLAEQQWIRKISELEGMLFPGLDIKGFPPNDTENAEAWLT
Q
Download sequence
Identical sequences Q6LS91
gi|54308617|ref|YP_129637.1| 298386.PBPRA1424 WP_011218158.1.54600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]