SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 298386.PBPRA3244 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  298386.PBPRA3244
Domain Number 1 Region: 16-98
Classification Level Classification E-value
Superfamily SpoIIaa-like 8.83e-17
Family Anti-sigma factor antagonist SpoIIaa 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 298386.PBPRA3244
Sequence length 103
Comment (Photobacterium profundum SS9)
Sequence
MNKAKIRLQSLDNGDYCLSGVLERDTVPAFWRQRCEWMPQGSKVTLDLSGLSRVDSAGMV
MLLHLSQQLINAGCDFTLLNVPEQLKTLLRLSHVESMLAAYIK
Download sequence
Identical sequences Q6LMC7
WP_011219802.1.54600 298386.PBPRA3244 gi|54310332|ref|YP_131352.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]