SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 298386.PBPRA3257 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  298386.PBPRA3257
Domain Number 1 Region: 4-141
Classification Level Classification E-value
Superfamily Phoshotransferase/anion transport protein 7.85e-40
Family IIA domain of mannitol-specific and ntr phosphotransferase EII 0.00000558
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 298386.PBPRA3257
Sequence length 143
Comment (Photobacterium profundum SS9)
Sequence
MSLDCTKSAVHCSSKKRALEIISEIAAEHLDQNPQPLFECILNREKMGSTGIGNGIAIPH
GRIQNSDKAIAILIQCQDPIQFDAIDNQPVDLLFALLVPDAQCKEHLKTLSSMAEKLSNK
QVCKQLRTAKSDEELYQIMTNES
Download sequence
Identical sequences Q6LMB4
gi|54310345|ref|YP_131365.1| 298386.PBPRA3257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]