SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 298386.PBPRB1019 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  298386.PBPRB1019
Domain Number - Region: 86-147
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000196
Family NfeD domain-like 0.0065
Further Details:      
 
Domain Number - Region: 28-91
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00392
Family LacY-like proton/sugar symporter 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 298386.PBPRB1019
Sequence length 152
Comment (Photobacterium profundum SS9)
Sequence
MIALLEQMNFWHWVAFGLALLLLELLGTAGYLLWLGVSAVLVGLLLSFLPLSWPLQWLTF
AVFSLFTMWLWWRYQHKKDRIEDEGRTLNKRSEQLIGQVSVLDEPLAAGTGRMRLGDTTW
LVRTDVALEAGVLVEVIDVDGIMLIIQPKVQK
Download sequence
Identical sequences Q6LII9
298386.PBPRB1019 gi|54302698|ref|YP_132691.1| WP_011221085.1.54600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]