SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 298653.Franean1_0607 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  298653.Franean1_0607
Domain Number - Region: 2-61
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0981
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 298653.Franean1_0607
Sequence length 67
Comment (Frankia EAN1pec)
Sequence
MAVPGVLNMVLADASSALKAAGFSNIPYLYECLGAASLGTVVTQSPAPGTSQGTSAAVDL
RLQANNY
Download sequence
Identical sequences A8KYH0
298653.Franean1_0607 gi|158312464|ref|YP_001504972.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]