SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 298653.Franean1_6077 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  298653.Franean1_6077
Domain Number 1 Region: 241-508
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.67e-60
Family Pyruvate oxidase and decarboxylase Pyr module 0.054
Further Details:      
 
Domain Number 2 Region: 18-225
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 7.98e-17
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.019
Further Details:      
 
Domain Number 3 Region: 527-627
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000000000628
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 298653.Franean1_6077
Sequence length 628
Comment (Frankia EAN1pec)
Sequence
MSEQVRERETRRLDRVVVRFAGDSGDGMQLTGEQFTSETAAFGNDLSTLPDFPAEIRAPA
GTPAGVSGFQLHFSDHDILTPGDAPDVLVAMNPAALKANLKDLPPGADLIVNTDAFTGGN
LKKAGYATDPLADGTLDNYTVHRVPLTSMTINAVNAAEGVAGTVNKKEAERAKNMFALGL
MSWLYHRPTGGTEGFLKKKFAKRPEIAAANIAAFRAGFNYGETTESFSVTYEVAPARMRE
GTYRRITGNIALSYGLIAAGELTKLPLFLGTYPITPASDILHELSKHKQFGIRTFQAEDE
IAGVGAALGASFGGSLGVTTTSGPGVALKSETIGLAVSLELPLLIVDIQRGGPSTGLPTK
TEQADLLQAMFGRNGEAPVPIVAPRSPGDCFDAAVEAARIATKYRTPVFLLSDGYLANGS
EPWLLPTREELPDLTVTFTTEPNHDGPKGPEFWPYQRDPETLARPWAVPGTPGLEHRIGG
LEKADGSGNISYDPANHDRMVRLRQAKIDGIARDIAPLEVDDPSGMASVLVLGWGSTFGP
IAAGCRRVRAKGLHVAQAHLRHLNPFPANTAEVLRSYDKVLIPEMNLGQLRTLIRSQFLV
DAIGYNQVRGLPFKAAELAGVLEDVINQ
Download sequence
Identical sequences A8LC84
WP_020463502.1.9268 298653.Franean1_6077 gi|158317819|ref|YP_001510327.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]