SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29883.JGI144334 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29883.JGI144334
Domain Number 1 Region: 102-221
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.33e-25
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000261
Further Details:      
 
Domain Number 2 Region: 218-264
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000000586
Family Retrovirus zinc finger-like domains 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI144334
Sequence length 264
Comment (Laccaria bicolor)
Sequence
LPTAISAAGVSQAQLDNYAIHLRLEEINRKLRLNDFIPPERERSASPPPTYDAHGRRTNT
REVRYRKKLEDERIRLVDRAMKNDPNFRPPVEYHQQKRSQRPSDKVYIPVKEFPEINFFG
LLVGPRGNSLKKMERESGAKISIRGKGSVKEGKARPDQYADDAEEDLHCLVLAETEEKVA
ACVRMINKVIETAASTPEGQNDHKRNQLRELAALNGTLRDDENQICQNCGGVGHRKYDCP
EQRNFTANIICRVCGSAGHMARDC
Download sequence
Identical sequences A0A0C9Y7W0 B0D9Z6
jgi|Lacbi1|144334|gww1.11.161.1 29883.JGI144334 XP_001880659.1.58555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]