SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29883.JGI181346 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29883.JGI181346
Domain Number 1 Region: 240-274
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000157
Family Retrovirus zinc finger-like domains 0.0043
Further Details:      
 
Domain Number 2 Region: 89-114
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000222
Family CCCH zinc finger 0.0055
Further Details:      
 
Domain Number 3 Region: 119-145
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000837
Family CCCH zinc finger 0.0066
Further Details:      
 
Weak hits

Sequence:  29883.JGI181346
Domain Number - Region: 170-192
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00981
Family CCCH zinc finger 0.0049
Further Details:      
 
Domain Number - Region: 145-168
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.068
Family CCCH zinc finger 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI181346
Sequence length 292
Comment (Laccaria bicolor)
Sequence
MAVANPLAGPSALRDVIHPQFHQNNFPAENYIKAELGVKLDKDDQICRLALTAAGCPLGP
LHCPLRHTTPTLQNFQPPRQLPTHPRERERLATVCKHWLRGLCKKGDACEFLHEYNLRRM
PECWWFAKYGYCSAGDECLYAHPKERRVECPDYNRGFCKLGPSCPRKHVRKVACQLYLTG
FCPLGPECLRGHPKPDLPPAKAYEPLEPPSTRDLGPPPPGYGRYADFDRGMNSGPVAHPG
STSAMQGPPRRNLDEVLCFKCGEKGHYANHCRNRNVPGNRGGNERLKRFGEE
Download sequence
Identical sequences B0CQ84
XP_001873837.1.58555 29883.JGI181346 jgi|Lacbi1|181346|estExt_GeneWisePlus_human.C_10506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]