SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29883.JGI232533 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29883.JGI232533
Domain Number 1 Region: 10-63
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000128
Family Retrovirus zinc finger-like domains 0.0026
Further Details:      
 
Domain Number 2 Region: 66-119
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000291
Family Retrovirus zinc finger-like domains 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI232533
Sequence length 133
Comment (Laccaria bicolor)
Sequence
SEARRLKRIEEKQAGTTCFACREKGHAAKNCPKATTEDGKGKSVGICYRCGSTRHTLSRC
KKPADTENPMPFASCFVCSGKGHLASACPQNKAKGVYPNGGCCKICGDTAHLAKDCGLRR
EGTQSPLIDLNFG
Download sequence
Identical sequences B0D1C4
jgi|Lacbi1|232533|e_gwh1.5.444.1 29883.JGI232533 XP_001877872.1.58555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]