SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29883.JGI244678 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29883.JGI244678
Domain Number 1 Region: 417-533
Classification Level Classification E-value
Superfamily HIT-like 0.0000000359
Family HIT (HINT, histidine triad) family of protein kinase-interacting proteins 0.031
Further Details:      
 
Domain Number 2 Region: 315-363
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000502
Family Retrovirus zinc finger-like domains 0.0059
Further Details:      
 
Weak hits

Sequence:  29883.JGI244678
Domain Number - Region: 363-394
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0267
Family Retrovirus zinc finger-like domains 0.0064
Further Details:      
 
Domain Number - Region: 15-76,151-224
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 0.0271
Family Protein serine/threonine phosphatase 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI244678
Sequence length 644
Comment (Laccaria bicolor)
Sequence
LTVGSVVGSIRELFAKIKAIDAKHGKFDLVLCIGDFFGPPEASADVTKLLLDGKLLAPIE
CYIMQGEYPLPEAVVQKFAITGGELGKNVFLMSKSGVISTAHGLRIACLGGIYEPNIYDS
ADAAPVCVVFVQTVERLLSNSLAQSGTGKNYKSLAAIQSAATSSSLIDILVTNVWPSAIS
QFSSVPFPGTRLDSVGAPPLDNLVRHTKPRYHFAAGHGQQPNFWEREPFLWDDEAGRLSR
FVGLGAFGGKPSIGKKQRWFYAFSISPNTAGPVSLPPNVTKNPFLEFAPQAVKRPFEATE
ADNYIFGNKGEPGKLPPGYKCRRCESTEHFISECPERTKPPEGYVCKVCNTPGHLVRDCP
TRDARGDTGGKKPKPGYVCRACGSEEHYLEDCHVANQQLNQGQRRGKRGPVKEIAPDECW
FCLSNPNLAKHLIVAIGSECYVTLPKGQIIPTHPVNNQFRVPGGGHVLIVPITHYPTYST
IPSDLAPSILEETEQYKTSLQAMYAKHGECAVVFEVGRLSAKGGHAHVQAVPIPLSLKDK
VEQAFITEGRQLGIDFEPDPEAAMEACAGGKGSYFKVDLPDGRKMVHLMKDHIPFSIQFG
RQVLVSLLDMPNRLDWKACTLSEADDRADAESFKVAFAPFDSSS
Download sequence
Identical sequences B0CSQ8
jgi|Lacbi1|244678|e_gww1.2.163.1 29883.JGI244678 XP_001875446.1.58555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]