SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 29883.JGI290751 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29883.JGI290751
Domain Number 1 Region: 31-117
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 3.14e-18
Family Supernatant protein factor (SPF), C-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI290751
Sequence length 199
Comment (Laccaria bicolor)
Sequence
MLLYTRYSLFAFFFFLPALISAHLVEVPAGKKDCYFEDLHKHDKMTVTYQVGEGGHLDID
FWLSDPSGTVLGKQIRQSTGSISITAEKDGRHEYCFSNQMSAIADKMVSFNVHGVIYVGG
DADVVAPIEREIRSLAAGLTSVKDEQEYIVVRERTHRNTAESTNARVKWWSVLQAIVLFS
VVAWQVYYLKSFFEVKRVI
Download sequence
Identical sequences B0CUX4
jgi|Lacbi1|290751|estExt_fgenesh2_pm.C_20059 29883.JGI290751 XP_001875298.1.58555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]