SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29883.JGI296601 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  29883.JGI296601
Domain Number - Region: 96-122
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000196
Family Retrovirus zinc finger-like domains 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI296601
Sequence length 148
Comment (Laccaria bicolor)
Sequence
MDRELINEIVEGAPSFWRSIITPHLFQDLEQLRLSVKFHEDSLLNMGGAKENTQQSPYNP
FRNVHVNLVGWTKATSNPQFPKDDSNVSLHGMLDEKGARPCRHCGSRKHWDRDCKYTRKG
EKRARANMVTTAAEDEQAQEDYDNAYYK
Download sequence
Identical sequences B0D984
jgi|Lacbi1|296601|eu2.Lbscf0010g04100 29883.JGI296601 XP_001880281.1.58555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]