SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29883.JGI302609 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  29883.JGI302609
Domain Number - Region: 234-256
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000117
Family Retrovirus zinc finger-like domains 0.0036
Further Details:      
 
Domain Number - Region: 135-189
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.0504
Family Retrovirus capsid protein C-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI302609
Sequence length 331
Comment (Laccaria bicolor)
Sequence
MADAANAKGDRCRAPKDFDGNEDKYKTWLRTVQTYMEVNDHLFSTDKRKIQFALSFMITG
RAADWAEHFTDTHLNTDGVFTTASTWKEFVQLLNETFDIRKTKDKARVDLSILKHKPGQL
EQYILDFTALASRAGYVLTGDVENPVLSQLFLEHLNPSLREKIETQKEPPETLKVIIEDA
RKFDKSYYKNQAWKTKLMGWQPTRNMPRQTPRPSYTPRSRDPDAMDIDRLTIEERNEYMK
KGLCFRCGKTGHMSRDHATNPALNTGKGNTSKPATPYKAIMPPPNKNAAQKVRAIMAGLD
DEELEEAKVAFIESLDKDPNEPESDDEDKGF
Download sequence
Identical sequences jgi|Lacbi1|302609|eu2.Lbscf0021g02140 29883.JGI302609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]