SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29883.JGI305285 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29883.JGI305285
Domain Number 1 Region: 317-389
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000404
Family RING finger domain, C3HC4 0.025
Further Details:      
 
Domain Number 2 Region: 213-244
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000458
Family Retrovirus zinc finger-like domains 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI305285
Sequence length 586
Comment (Laccaria bicolor)
Sequence
MASSVFYKFSSRKDESRVTFDGTGISVFDLKREIILANNMGKANDFDLFVYDSTSKQELK
DDSQIIPRSSSVVVKRMPAVRPGKGKASMYIGAASAPGPVSESVQRPGSSTTWHKGAMSK
RFDGKEEPSASTIPKPSTLMKSAVTKDDEAAAMAAMFQASSANWEETQEKMSQFVYPTRA
FVDVVDQNLMNINPRGTGFGRGSGKPHIPQLQAQQQDRPLPPSYVCYRCGQKGHWIQDCP
TNNDREFDNRPRIKRTTGIPRSMLKAVENPNSGDLAQGVMVTPEGGFVVAQPDLASWQKQ
VSRPKGLTVAEVRERAPTDTSLACPIDNKLFRDAVKTPCCGTLYCEECIQTHLLERDFVC
PHCSKKIASLDKLLVDKPARTKVTDYIEKAVEDSKKEASEDSTPAAGGDRTGDATGQAEN
GEQSNQEQDLYSDQQPDLSMEMSQMLVDSIPQLQAQINQLSVMLQTSSLPNQVRHQTEMQ
YQQLQIQLQQAQAISAALAVATFQQQQQQQQQQQQAQNLVTGGMGYGMQYQQNWGNQFSN
QQPAGQDSAYQRLPVNNRRRNLKRDRPSDFFDVAGENESKVPRYWE
Download sequence
Identical sequences B0CTW0
jgi|Lacbi1|305285|eu2.Lbscf0002g03430 29883.JGI305285 XP_001875125.1.58555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]