SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29883.JGI306073 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  29883.JGI306073
Domain Number - Region: 972-1000
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000628
Family Retrovirus zinc finger-like domains 0.0071
Further Details:      
 
Domain Number - Region: 314-358
Classification Level Classification E-value
Superfamily FAD-dependent thiol oxidase 0.0798
Family FAD-dependent thiol oxidase 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI306073
Sequence length 1080
Comment (Laccaria bicolor)
Sequence
MATPSQSNADLVDSTDKPKTTGRSTRAASKNLQLAEESTKGASTSAVPPAKGKATATSPI
VEESAKGASTPAVPSVKGKLAVTSQTKPIKPGASSQKAPALIPLPQSGVSAPQGSVVLIM
INPPGPNLTMLQETGQILSDAPSLTYLTMISSISTLGHKSPRGSQRIFEGIPTYEDVLIY
DEPLSISLARYHPRFNPAVDDDPLIFFGGIDGKLPGKSLEDSQGIRDLLWRWSAPHVQGL
WVNLPTMIDSFPQVRLTPEYIHELTVDSVKYYSVPSVLLEEIAQLYLAMYQILHAFQTLL
GEGDCQLFAFDPEWKMLHLLAWHTNKKDILLTFVVLQRRCQVCNSHIKEYFNAMRKIFLQ
SDEQQSVSTLYSTRPSVRSRFGQDEAHEEVGKLLLRSDYEAEVPAAYRDGVSRLTEAAVA
AANRMNERVPTVFYKDPRARVDNTPPTGAVVAARSASNASYKVRALDQVFAKLPTSRDLY
ATSQSNRAFSLLAPSIAPTTQYAPSAVPTIATQSVKVPMPASISVVAHRRHAISTMPGLG
KIELPAGDAPAAAPVVNTGVEQGSQAVAKPTPTVWFASRQTPPHLATTAPEQPPAPASSA
PSRWTSYQFKDNRPIPSPSDDDLRSPSDPPSGGGPPDDDPGNNGPGGGGPNGGSGGPNGG
PPGGPPGGPPRGSGDPSPGNPSGWTGYSPFPYSDEWQLNHKLNSSVVPAWDGHGSTAIDY
ISSMSFLARMSDKMKEGVAAMAPYKWSGHAKSWWECLPLTDQTYFRQDWEHMMIGLHVQF
LDLRWSRERLYEFEAMFFHQKGHTTEDPIDFIQRRVRHHMFLHPDDQDGPGAVDRILRNQ
PIEWEKDLNDVNCPSIFALQSAASRLATSLINDWQSSEIRARNTAVGQGDKPSVPGKGRY
GRTAHNVSLDPPTGPPALIHDEGSDSSTDESAEAFAATFRKRNEKGSAASSSKWPRGKVM
NGVSFPRDDSVKSAKPPTNGACFICDSPYHYARDCSHYGKWDGLRNANLIDVDLDHELEA
AHDREYLAMIVETQAEASSSTYIAGLSKTSKEAFCMSAELTGAKALHAKKTFMTDNRNIR
Download sequence
Identical sequences B0CSN4
jgi|Lacbi1|306073|eu2.Lbscf0002g11310 29883.JGI306073 XP_001875431.1.58555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]