SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29883.JGI309136 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  29883.JGI309136
Domain Number - Region: 6-42
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000126
Family Retrovirus zinc finger-like domains 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI309136
Sequence length 179
Comment (Laccaria bicolor)
Sequence
MSKYAPHRRSTNQPRATSSTICQKCLGRGHFIYECKESRPYVSRPSRTQQLENPRLLAKL
KADGKPSVQVPEEFKKKTGTANMILEAKEKERSKDEKGKEKERPRKKAKRSSSSSGSDSD
SDSGSSNSDSSSSRSSGSDSGSSSGSSSGSSRSRKRSRKRRVARRGPSPSSRDGHSDDD
Download sequence
Identical sequences B0CVM7
29883.JGI309136 XP_001876269.1.58555 jgi|Lacbi1|309136|eu2.Lbscf0003g07750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]