SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29883.JGI310175 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29883.JGI310175
Domain Number 1 Region: 43-88
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000419
Family Retrovirus zinc finger-like domains 0.0039
Further Details:      
 
Weak hits

Sequence:  29883.JGI310175
Domain Number - Region: 11-48
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0781
Family Canonical RBD 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI310175
Sequence length 143
Comment (Laccaria bicolor)
Sequence
MRRRPDQRLAHVIITFSDADTANRAIVNGLSICHKRVSVAKCRKEPIRCLKCQGWDHIAA
ECVVTKEVNVCGTCGARDHWTSKCNQQGVTHCTSCKSDDHTSWDRGCPTFLRKVDELNAR
DPANDIPFFPARETWTWSQSYPS
Download sequence
Identical sequences B0DU07
29883.JGI310175 XP_001887333.1.58555 jgi|Lacbi1|310175|eu2.Lbscf0044g00530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]