SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29883.JGI310466 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  29883.JGI310466
Domain Number - Region: 329-348
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0863
Family Retrovirus zinc finger-like domains 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI310466
Sequence length 379
Comment (Laccaria bicolor)
Sequence
MSAPVTLRSFSGETDDDVQPGEFLKTFRCFTTSARITDDDLIITSFGDHLKYGSPADDWF
TELTSTKQTWKEVETVFLQCFPPVEKAKRTETKLERELCELRLKTEDLGKKEKYAGEEVY
THVIFAEKALSLAKQAKISTGSNSIWKVRDELPDIIRQKVKETYPTWTEFCAAIKGVEMA
HIRDGVKKYQKEKEEKEKTEAAIASLQRLHLQGQRRPPAAPTSSVSNVSQTQQSSTLGGQ
CNNTPQSNSTNTNAYMGPSSGQGNLPHPAPSPITEADRSALICSLALYPMQPNTEAGIAA
WHAQLREWKAKNGETAEVTVNMGFPLQPGGEAPGSGECYRCGRGGHRRIDMRCTTDQINN
KERTFRTICGRILRAAPTS
Download sequence
Identical sequences B0DUE4
29883.JGI310466 XP_001887602.1.58555 jgi|Lacbi1|310466|eu2.Lbscf0046g00450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]