SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29883.JGI311354 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  29883.JGI311354
Domain Number - Region: 39-66
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00555
Family Retrovirus zinc finger-like domains 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI311354
Sequence length 100
Comment (Laccaria bicolor)
Sequence
MQPNTKAGIVAWHAQLREWKTNNGETAKVTVNTGFPVQPGGAAPGSGECYRCGRGGHCSN
CKPAKNQSAQRIDLVIHDVESFYTYFSKGLLGSYSPLFNP
Download sequence
Identical sequences B0CZT7
XP_001876475.1.58555 jgi|Lacbi1|311354|eu2.Lbscf0004g03100 29883.JGI311354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]