SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29883.JGI313476 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29883.JGI313476
Domain Number 1 Region: 154-190
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000401
Family Retrovirus zinc finger-like domains 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI313476
Sequence length 203
Comment (Laccaria bicolor)
Sequence
MIGVIDEHEKVVKFWNGLRAPLQKQLWIFGLNPEMSSWEEIQEGAETFETSEKFDPQHRR
SNNNNNFGGGAPSSSHQNNRTHPSEKNRSGQKRFGSQTTRGSSQTPSTQQKPPNSQTGNN
RFRSQTPRNSNGHFNNNKREWKSSKPTNFQREKSTPRLSDKEKTELLASGSCFKCKKPGH
LSRNCPDGNNVHASGSKPPGLXX
Download sequence
Identical sequences jgi|Lacbi1|313476|eu2.Lbscf0005g00650 29883.JGI313476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]