SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29883.JGI314345 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29883.JGI314345
Domain Number 1 Region: 9-44
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000349
Family Retrovirus zinc finger-like domains 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI314345
Sequence length 75
Comment (Laccaria bicolor)
Sequence
MLIQDNIGYACGGVGHCSRDCFQGFKCYNCSGVGHISRDCPHDRSGLVILAGQNATSPVT
ALPVGQRPSDCKDVP
Download sequence
Identical sequences B0DYC2
jgi|Lacbi1|314345|eu2.Lbscf0060g00420 29883.JGI314345 XP_001888921.1.58555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]