SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29883.JGI315050 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29883.JGI315050
Domain Number 1 Region: 387-431
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000131
Family Retrovirus zinc finger-like domains 0.0039
Further Details:      
 
Weak hits

Sequence:  29883.JGI315050
Domain Number - Region: 117-159
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0144
Family Apolipoprotein A-I 0.027
Further Details:      
 
Domain Number - Region: 130-219
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 0.0262
Family FAT domain of focal adhesion kinase 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI315050
Sequence length 490
Comment (Laccaria bicolor)
Sequence
MSGTGAKPRTQTTLTSKGKMTITRQAQPVEAEVQPQERKRTRAAGSVEMEGNDQEISDAE
KGKIYLEETLTFVPAGATPTLDALSTALFQIAAMQGMGHPAVNAVRAVAYLLKEIELEEV
TKAIRSIANTQFGEMASDLKEYMEGLKEKVAEVLEKRTEVLEKKTGELVEVMEKAAQQAG
SIGNSTYRDALTRSASGAPPDTNPRLAAKESIRQRQALIDLPRDSKLRDCANTVLVGKFS
EAMGKATSQKHKMRSALKLQNGGILVEMVTDDGTAWLASKANAEAFLWELGEPEASFKTR
SYNVIAYYVPLSLDPSSEKDRKEIEETNGIPTGVLTKIRWIKPPMRRRLDQRLAHVIITF
SDADTANRAIVNGLSICHKRVSVAKCRKEPVRCLKCQGWDHIAAECVVTKEVNVCSTCGA
RDHWTSKCNQQGVTFCTSCKTDDHTSWDRGCPTFLRKVDELNARDPANDIPFFPARETWT
WSQSYPSQGR
Download sequence
Identical sequences B0DZP3
XP_001889410.1.58555 29883.JGI315050 jgi|Lacbi1|315050|eu2.Lbscf0067g00030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]