SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29883.JGI315285 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29883.JGI315285
Domain Number 1 Region: 532-628
Classification Level Classification E-value
Superfamily DNase I-like 0.00000000000144
Family DNase I-like 0.02
Further Details:      
 
Domain Number 2 Region: 345-391
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000377
Family Retrovirus zinc finger-like domains 0.0036
Further Details:      
 
Weak hits

Sequence:  29883.JGI315285
Domain Number - Region: 305-350
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.003
Family Canonical RBD 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI315285
Sequence length 633
Comment (Laccaria bicolor)
Sequence
MRAAGSAEIDKDEQEIGDSEKGRSYLEDKLLLIPQNAPLTLGALAMALCQIAALPGVALP
AINTVCAVTFLLRDVELGAVAEDIRDIAITQFTELTSDLREFTEGLRVKVMEELEKKMEV
LTEKTVELAEVVEKVTQQAGNTASSPYRDALIRATSGAPLNANPRLAAKESIRQGQSLVN
LPRESRLRDCTNLVLVGKFSEAMGRATALQHKVRSALKLQNGGILIEMATDEGVAWLATK
PNAESFLRELGETEASFKTRSYNIIAYYVPLNLDTNSEKDRREIKEANNFPKGAIMKLRW
IKPPARRRTDQRFAHVFVTFSDADSANWAIVNGLSICNKRVSAAKSRKEPIRCLKCQGWD
HIAAECVVSRDVNICGTCGARDHWTSKCEQQGTVFCTSCKTDDHTSWDHNCPTFLQKIED
LNARDPANDLSFFPARESWTWVPFYPLHSQRVPPAEIQVNDAQAGSQKTRYRQTQLGFEP
TVPGGRPYTRAPRARQHSKTPVAESLPPIFPNPESPFAPPPMSEPPESSITRLQILQINL
NKSSKVHLELYNKLSRKDWDIILVQEPHVTAMGNIRTPNGYVMVAPVDRYKDGAPATKAV
TWVSSDLATNSWKILNVPGTNNITTIQLAGIYG
Download sequence
Identical sequences B0E090
29883.JGI315285 XP_001889579.1.58555 jgi|Lacbi1|315285|eu2.Lbscf0069g00670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]