SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29883.JGI315860 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  29883.JGI315860
Domain Number - Region: 177-200
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000148
Family Retrovirus zinc finger-like domains 0.0044
Further Details:      
 
Domain Number - Region: 79-133
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.0778
Family Retrovirus capsid protein C-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI315860
Sequence length 284
Comment (Laccaria bicolor)
Sequence
MITGRAADWAEHFTDTHTNTDGVFTTASTWKEFVQLLNETFDIRKMKDKARVDLSILKHK
PGQHEQYILDFTALASRAGYVLTGDMENPVLSQLFLKHLNPSLREKIETQKEPPKTLKVI
IEDARKFDKSYYKNQAWKTKVMGWQPTRSMPCQLPRPSYTPRSQDPDAMDIDRLTIEERN
KYMKKGKCFQCGQTGHVSRNHTTNPALNTGKGSTSNSRKPATPYKAIMPLLNKNATQKVR
AIMAGLDDKELEEAKVAFIESLDKSPNEPAKEESDDEDENKGFQ
Download sequence
Identical sequences 29883.JGI315860 jgi|Lacbi1|315860|eu2.Lbscf0006g05440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]