SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29883.JGI317847 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  29883.JGI317847
Domain Number - Region: 98-124
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0188
Family Retrovirus zinc finger-like domains 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI317847
Sequence length 126
Comment (Laccaria bicolor)
Sequence
MSNPLDLATQQEIRHTETLPAHTIFHELQALIRPLAGHMQTQEELNLARDKICAIQLGDA
FTGLRDPHVSNPKGRPSTTRLTGPSEGHARGGGASRAHHLTNRLQCNCSVCHQPGHNRST
CPQCWD
Download sequence
Identical sequences B0D5D4
jgi|Lacbi1|317847|eu2.Lbscf0008g00290 29883.JGI317847 XP_001879383.1.58555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]