SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29883.JGI321942 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  29883.JGI321942
Domain Number - Region: 4-30
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00192
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI321942
Sequence length 532
Comment (Laccaria bicolor)
Sequence
MGKMPPSPCKCCGSANHWDKECPDWNTYLERAKRSANSVEIWPEDEADKAYASAYSVLLN
ERLTDQSTNQPVPLESPIQQGFEQASSTSQTPAEEASKTSVAEVYKASRRASVEEVEDED
YIAHLIKPKSPKHLLEKIDELGFEDNEDSEKVEPNFRSPPLHSDEFDSLASDLQTEEAPT
KEAYSSNTTTGPPTTDHKVKLKKRRFTPAGSSAVGVSVVAVQGWVGSQRNDQIDLRLDSC
ADVTLISQEYLESLKDRPACQKGLKMDLWQLTDKDSKIQGYVRIPIFMESSEGVIIETEA
EAYVVPDMTIPILLGEDYHLNYELTVAHRIDFKSVVNFSGAPYSVPARGRNKAKKARDKK
RFGIEKRTVRASEDCRLRPDECRRIRVDGHFEEDRTWLVEKNLLASNNDSAFIVPNVLIS
ASDPWIPISNPSPHPRMIRKGDIVGYLVDPQEFFDTPSSKDEFEKLARSAQAIAAIISIS
SETTQGETSQKSEPSEHNEVPEDPTIKVTPAEEPEAFAISFLPTTFFISPWQ
Download sequence
Identical sequences B0CUQ6
29883.JGI321942 XP_001874693.1.58555 jgi|Lacbi1|321942|fgenesh3_pg.C_scaffold_2000476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]