SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29883.JGI322542 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29883.JGI322542
Domain Number 1 Region: 248-277
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000481
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 
Weak hits

Sequence:  29883.JGI322542
Domain Number - Region: 289-397
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000294
Family alpha-catenin/vinculin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI322542
Sequence length 416
Comment (Laccaria bicolor)
Sequence
MPDPSSSSIEEPAPTDQMEDLFAEYGINSDMEKKKKLGKYTDQRTEFEWKAFKTFEDGSF
DEFKKALIADYPDARNAGKGTLTGLRAGTTKITHGAASTGCLTDSFADQVKASLNIEQTR
DRKQKGNEDETTARRTEDPYDIIDIIDMAETIAGRLTGDSRDHPSNARAVSTGRSVQARE
QEIKTEHDEFEELRSITATFLDQIKVDQKQNSELHNMVQNTQIEMKKLLETLVHQQPNIS
NPQSKVASYKMTSDGCWYCDEPGHFTSNCPHREAHVAQKKIKLLGNRMYFMHNNTAVPRG
NGEKSVRQIVEEASRQNSTLQNNMFAEPGEVFSQEAVVPGIIRLPDNNNGNEISIFTNQM
RDTRDDVILNMNNQVLKLTDMLANLVTNPNKTRDVDASQFAVTRRSQTETQGQSGN
Download sequence
Identical sequences B0CWP0
jgi|Lacbi1|322542|fgenesh3_pg.C_scaffold_3000159 29883.JGI322542 XP_001876040.1.58555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]