SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29883.JGI322715 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  29883.JGI322715
Domain Number - Region: 139-171
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0942
Family Retrovirus zinc finger-like domains 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI322715
Sequence length 290
Comment (Laccaria bicolor)
Sequence
MYTSLFNSESFLAATLFIECLVQKEEHICTLIKTCHDDPTLSLDLHLILEAIATEKHLKG
KLGYKDESVLSLHHMVTTAIAAAIRHGILNTIRDCDKLPAVPDYIPSHFAGRGIIQYFEK
FDAEIHAYGKKFPTSTCITAHHPYRRTPTPRCSKCKRLGHIRHTTPNCETKKKSDKAWEW
EKNMRPAGYDTMTGTQMWKERIYDWTRVPIHRNEDWNTPRKQPEFVDLTSPSPPSSPSMQ
PLFPPTPPSSPSYNPYSPMTHPSPLFDLKDLVSDFDSITSSSGNISDIEV
Download sequence
Identical sequences B0CX97
XP_001875713.1.58555 29883.JGI322715 jgi|Lacbi1|322715|fgenesh3_pg.C_scaffold_3000332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]