SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29883.JGI323169 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  29883.JGI323169
Domain Number - Region: 571-605
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0351
Family Retrovirus zinc finger-like domains 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI323169
Sequence length 626
Comment (Laccaria bicolor)
Sequence
MSIREAPLLLGRVCSEWRSITLSTPRLWASLHIPAPAPHSLSEYFASILKIEKQCKGTEE
WIRRSGQCPLSISLHTPSPHYRFNMAEMQPFVEVSKWILPSTKRWKNFSFKAPTDSSPHF
QKIAEGDVPMLEALGITIVPRTIYISGLLSAPKLRKLSLTRFRDNLLSLPVHWSQLTHLT
LDAEGSSKQFLGMPSPLTYREVSKVLKNCSLLSMSGTRLKPKSQAAPPQKGKVTTTRQNR
PADTEVQERGKTRATGSVETDEYEHEIGDSDKGRSFLEGRLLMVPAGALLTLGALATTLF
QIAAMPGVALPVVNAVCTVAFLLRDVELEVVAEDIRDIAIAQYNELTNDLKDFTEGLRVK
VMEELEKKTEVLKEKTVELAEVVEKVAQQGHVDKDGLWSPNGCQSLSSCKGEHQAMTISN
RPTQGIKPQQLRQSGSGGLALKLQNGGILVEMVTDDGAAWLASKANAEAFLQELGEKEAS
FKTRSFNVIAYYVPLNLDDNSEKDRGEIEEMNNIPKGTLTKLRWIKPPARRRPDQCFAHV
IATFSDAESANRAIVNGLSICHKRVSVVKCKKEPIRCLKCQGWDHVALECVIAKEVNVCG
TCGGDHWTRQTLTQAGTAAVRPSSGK
Download sequence
Identical sequences B0CZC0
29883.JGI323169 XP_001876857.1.58555 jgi|Lacbi1|323169|fgenesh3_pg.C_scaffold_4000072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]