SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29883.JGI323223 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  29883.JGI323223
Domain Number - Region: 625-664
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000957
Family Retrovirus zinc finger-like domains 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI323223
Sequence length 710
Comment (Laccaria bicolor)
Sequence
MSKSSTPIPPSGTTNTSRGKETALDTSTQNVFTPGTPDIPEDLDMTEVPFFNTVQGPDQE
TPIPSMVEPEHPDIEDLTELGTPFAFEDLPDRGSYREIFIEFPGCMPFSSFGETVTDTGF
DRSEKIFALAGRHRQALQLGEAALRRPIYNSYNKVVTRKGRKDLFKEEMDTLKELLSRLY
YFNDESNVAGFALQRIILVNLNHQLKARRNEAEEDFIISGEGVPTLPRWGLNSKADEFWS
ANDFEILGACFRREVENFLAYLAEHHDFSKAKKGNKHEQRTTIITKPSHKKVISAHLSRN
KGHANRFAANRNTSVFGHPAQNSSSHTFKELFGVRQGEDAIESQNGDDDSVHSGSHKSGT
GIYNQQGQRRSGGDPGDPDGSDSDDGGSNGPRRGPKRTAVPDKSRRNPFETTPEGGNSTT
VKAPPEPQFDTKLKMDTIPTWDGNPENLRRWLLKINSLAKRSTIVFKQLGSAEIWYYSQS
VDTRDRIEQDWSTLRAAIGEYYMNRAFLDRQKARANRASYRDMGNGRETPKRELINEIME
GAPSFWATVVTPHLLLDLEQFQLSVKFHEDSLLRLGGGENSLNRQVNSNYSKDNSQRNPY
NPFRNARVNLVGWTKAASNPQFPKDDANVSPRGTPEEKGARPCRHCGSGKHWDKDCRHAR
KGEKRARVNAVTTTAEEDRAEEEYDNIYYERFSDEEDIEDNPDFPKPSQP
Download sequence
Identical sequences B0CZI0
XP_001876892.1.58555 jgi|Lacbi1|323223|fgenesh3_pg.C_scaffold_4000126 29883.JGI323223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]