SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29883.JGI323267 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  29883.JGI323267
Domain Number - Region: 701-741
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00299
Family Retrovirus zinc finger-like domains 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI323267
Sequence length 787
Comment (Laccaria bicolor)
Sequence
MTTKCPLFETTKFVVWLTMLTPVVKAWTMTTGLGIERHDKLHWNTPTYESANSNIGGHTG
KYPYDLFTNDSMDNTKKTANPGRKTNNSQSAGMTRQTSNTPTSGTTTTPRGREAKLETST
QNMFMPGTPELSEGLDIPEAPSFQTAQERDQPSIISEGIEPEHPGVEDLTDLGAPFAPEE
LPDRGSYKEVVVEFPACMPVSSFGKSVTETGLDRSEKIFALAGRLRQALQLGEAALRRPI
YSSYGKIVSRTERREIFKEEMDVLRELLTNLYHFDNGANQVGFALQKIILVNLNQQLKSR
RNEAEEDLITSGEGIPSLPKWGFTGKADEFWSANDFEILGACYRREVENFLAYIAEHHDF
AKIRKNRRPEQRVVTSNSISTHLKKSRTRFSHPMANVNSSAFGHPVQNNSSHALKELFGV
KRHEDPLGSNVPRGTANFEPRLICESQGEDNSQETVFSNNRAKEAGTQEIQTATTAMMGK
GIMVRAEDPGNLSHQVTHEKTRLVPSQGKETQSLAKRSDIVFKQLGSAEIWYYSQSVETR
DRIEQDWNTLRAAIGEYYMNRAFLDKQKARANRASYQDAGNGRETPSEYVIRKLELLQFV
YNYTDRELINEIMEGAPSFWRSIITPHLFQDLEQLRLSVKFHEDSLLNMGGGENSYQNAN
RQGSQGQAKENTQRSPYNPFRNVRVNLVGWTKATSNPQFPKDDSNVSPHGTPDEKGARPC
RHCGSGKHWDRDCKYARKGEKRARANMVTTAAEDEQAQEDYDNAYYERFSDEEDLNDDAD
FQKPSQL
Download sequence
Identical sequences B0CZN7
jgi|Lacbi1|323267|fgenesh3_pg.C_scaffold_4000170 29883.JGI323267 XP_001876446.1.58555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]