SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29883.JGI324495 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29883.JGI324495
Domain Number 1 Region: 213-258
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000293
Family Retrovirus zinc finger-like domains 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI324495
Sequence length 959
Comment (Laccaria bicolor)
Sequence
MPDNTQDEAPATGGRRSSRPMPLPGSRGAPNFDKEKPIELLRFIDQMEDLFTEHGIDDDQ
EKKKQLGRYTDQKTEFEWQAFDMFAPEVEYKEFKQVLIDDYPEAKMAGKGTLANLRKICK
DHQHIDIDDFIALKNLTRSFRAEQKLLLTPPALDVHKGLALQVIPGVKLEDDIRELNQKF
ALLMDKITSSEKAQMSAFQASRQEMNKLTETLMTQHVTSAPTMRQTQPTWRMGSDGCWYC
EETGHFAMNCPHREEHIRTGKIKMSGHKMFFALTGQPVPRGTNGKSAKMIVEEASNKDMM
AQSNMFASPGEIYTQNSGEPGIVQLGIDARVARPSAQEVDIVNNMKNILSYFEGQQGQGQ
EAASYVATRRSQADTQGQQGFSQLAEFEDSDDEQEEEIEEVEQEIPPVVIKKTQKAIPKP
KEKPKPLLPRDDEEEDPVPRHKQLPYLNIPDLNDPRQKEEIKIDNFEPIIDTEKRPVSYK
HQAPIENVTHEREALANLYNAPVTLTAETLISISPGIRHDLIKALSKKRMPVQQAQNRKV
TMMEEPDIDAVPLKPTKFELEADAISINDLNIKAAFIVTTRDEGNVPKGSIIISDPVAQY
LQSLVEPWGNHGAYNTLASSKFGLTLVKPSDVDFRSDWDRSITAITTLQGLIATSQDHKF
FVLAEGVNSSLRFTAPIFTLKDPAFDPPGSELDTNAWPVRANEREALADLVQTHKVLPLM
VYDETEAAVLPMNVTETIKGALVELTFRLKHYYIQDKNYDTFSAAIEQIIVLKRAPPKQP
SPYRRGAGPVRLPTTGPTRSEQVAAVSVFYPPVPTGSAPVQLNPTLGVATPTIQAIASKG
AVGTERIPIAEQAPVSPLQSPLPIRGPNDQFTPWPPNTPPRRSDGSSTASSEPYSEFTTP
QTPKTPSPSGPTQQSALPQNAAAGPSNLRSGHTMVNDGKRKAGPGDEDGSNAKKGRTGV
Download sequence
Identical sequences B0D201
XP_001877977.1.58555 29883.JGI324495 jgi|Lacbi1|324495|fgenesh3_pg.C_scaffold_5000602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]