SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29883.JGI325430 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29883.JGI325430
Domain Number 1 Region: 2-36
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000984
Family Retrovirus zinc finger-like domains 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI325430
Sequence length 195
Comment (Laccaria bicolor)
Sequence
MRQTQPTWRMGSDGCWYCEETGHFAMNCPHREEHIRTGKIKMSGHKMFFALTGQPVPRGT
NGKSAKMIVEEASNKDMMAQSNMFASPGEIYTQNSGEPGIVQLGIDARVKSVYTNQIRDS
RDDLLDKMATRIDTLLGNKVPAQVAHPSAQEVDIVNNMKNILSYFEEQQGQGQEAASYVA
TRRSQADTQGQQGFS
Download sequence
Identical sequences B0D4V9
XP_001879080.1.58555 29883.JGI325430 jgi|Lacbi1|325430|fgenesh3_pg.C_scaffold_7000332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]