SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29883.JGI325548 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  29883.JGI325548
Domain Number - Region: 214-238
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000174
Family Retrovirus zinc finger-like domains 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI325548
Sequence length 454
Comment (Laccaria bicolor)
Sequence
MRTHYLHYLKGIKDNYLGRTWQITMNRKYEGQSFRQEGFERESPPAYIVRRIMYTRMLVA
SDDGGPTEVYLVMQKAPISWGPILNLETVRSTSLLYSRATDHELALVHAAKYESTNVLTS
DNLLYTLRKLGISVDRNRPFDRSAKMVTSTNEKGEEVIHEALLSQLSREGCLQEITLDPE
IMREAFAVLKKRQRPPPKGGYPYSKNDHVTTKMGRLPPSPCKVCGSPNHWDKECPDWAFY
EAKQQKTAYRIETNEEEELEGYYASVYSILVTERLASETKSSSESSDFHKAVPQERINSF
HSERKSDNNTPWKRQAVFMEEEEDEFWAEYRQKEKSSSHLLYQVGDEDDESPQKEAFSAC
TEDAPSSQKPESDKDPPREVKDPPREVKDPPWEKDPLSAPPAKEKPFKIPKARSRPEGMS
AIGVSVLSTKGFVGGLNNVETDLRLETGGYHFYD
Download sequence
Identical sequences B0D5F7
XP_001879148.1.58555 29883.JGI325548 jgi|Lacbi1|325548|fgenesh3_pg.C_scaffold_8000042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]