SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29883.JGI327797 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29883.JGI327797
Domain Number 1 Region: 248-277
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000481
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 
Weak hits

Sequence:  29883.JGI327797
Domain Number - Region: 292-400
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000722
Family alpha-catenin/vinculin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI327797
Sequence length 416
Comment (Laccaria bicolor)
Sequence
MPDPSSSSIEEPAPTDQMEDLFAEYGINSDVEKKKKLGKYMDQRTEFEWKAFKTFEDGSS
DEFKKALIADYPDARNAGKGTLTGLRAGTTKITHGAASTGCLTDSFADQVKASLNIEQTR
DRKQKGNEDETTARRTEDPYDIIDIIDMAETIAGRLTGDSRDHPSNARAVSTGRSVQARK
REIKTEHDEFEELRSITVTFLDQIKVDQKQNSELRNMVQNMQIEMKKLLETLVHQQPNIS
NPQSKVASYKMTSDGCWYCDEPGHFTSNCPHREAHVAQKKIKLLGNRMYFTHNNTAVPRG
NGEKSVRQIVEEASRQNSTLQNNMFAEPGEVFSQEAVVPGIIRLPDNNNGNEISVFTNQM
RDTRDDVILNMNNQVLKLTDMLANLVTNPNKTRDVDASQFAITRRSQTETQGQLGN
Download sequence
Identical sequences B0DCV3
29883.JGI327797 jgi|Lacbi1|327797|fgenesh3_pg.C_scaffold_14000044 XP_001881754.1.58555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]