SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29883.JGI327836 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  29883.JGI327836
Domain Number - Region: 384-424
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00107
Family Retrovirus zinc finger-like domains 0.0052
Further Details:      
 
Domain Number - Region: 120-216
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 0.0366
Family FAT domain of focal adhesion kinase 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI327836
Sequence length 498
Comment (Laccaria bicolor)
Sequence
MSGTGGKPRSQTASTQKVKPTVARQNRTTKVESQERGKTRAAGLVEIDEGDQEVGNAEKG
RAYLEEKVLLVPPRDPLTLYGLIVALFQIAALPGIGCPAINAVRTVAYLLQEVETGAIAA
DIRDIANEQFSEMTKDLGELMEGLKEKVLEEVGKTTVVLEKKTLELAGVVEKVAQQAVSA
GSSPYRDALSRTVSRAPLDANPRLAAKENIRQRQSLIDLPRESKLRECTNTTLVGKFSEA
IGRATAQKHRIRSVTKMQNGGILVEMVTDEGVAWMASKANAESFLRELGEAEASFKTRSY
NVVAYYVPLNLDTNSEKDRKEIEEMNNIPEGGLAKLRWIKPPSRRRADQCFAHIIATFSD
ADAANQAIVNGLTICHKRVSVAKSKREPIQCLKCQGWDHVAAECSLEKEVNVCGTCAKDH
WTSRKTTPAGIAAAQLSSGRLKISMRGTRPTTCLSSQRRNPGLGRHPIRPKLVGRRQQRF
RSTQFRQVHREIGSDKHS
Download sequence
Identical sequences B0DCZ6
29883.JGI327836 XP_001881776.1.58555 jgi|Lacbi1|327836|fgenesh3_pg.C_scaffold_14000083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]