SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29883.JGI328208 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29883.JGI328208
Domain Number 1 Region: 223-268
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000205
Family Retrovirus zinc finger-like domains 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI328208
Sequence length 376
Comment (Laccaria bicolor)
Sequence
MPDNTQDEAPATGGRRSSRPMPLPGSRGAPNFDKEKPIELSRFIDQMEDLFTEHGINDDQ
EKKKQLGRYTDQKTEFEWRAFNTFAPEVEYKEFKQVLINDYPEAKMAGKGTLANLRKICK
DHQCINIDDFIALKNLTRSFWAEQKLLLMPPALDVHKGLALQVIPGLVSMQQKHGQHESI
TCIICQYIKVALLMDKITSSEKAQMSAFQASRQEMNKLTEMLMTQHVTSAPTMRQTQPTW
RMGSDRCWYCEETGHFTMNCPHREEHIRTGKIKMSGHKMFCALTGQPVPRGTNGKSAKMI
VKEASNKDMMAQSNMFASPGEIYTQNSGEPGIVQLGIDARVKSVYTNQIRDSRDDLLDKM
ATRIDTLLGNNVPAQV
Download sequence
Identical sequences B0DE29
XP_001882123.1.58555 jgi|Lacbi1|328208|fgenesh3_pg.C_scaffold_15000196 29883.JGI328208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]