SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29883.JGI328732 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29883.JGI328732
Domain Number 1 Region: 152-181
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000481
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 
Weak hits

Sequence:  29883.JGI328732
Domain Number - Region: 195-298
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00377
Family alpha-catenin/vinculin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI328732
Sequence length 320
Comment (Laccaria bicolor)
Sequence
MFLGCLTDSFADQVKASLNIEQTRDRKQKGNEDETTARRTEDPYDIIDIIDMAETIAGRL
TGDSRDHPSNARAVSTGRSVQARKREIKMEHDEFKELRSITATFLDQIKVDQKQNSELRN
MVQNTQIEMKKLLETLVHQQLNISNPQSKVASYKMTSDGCWYCDEPGHFTSNCPHREAHV
AQKKIKLLGNQMYFTHNNTAVPRGNGEKSVRQIVEEASRQNLTLQNNMFAEPGEVFSQEA
VVPGIIRLPDNNNGNEISVFTNQMRDTRDDVILNMNNQVLKLTDMLANLVTNPNKTRDVD
ASQFAVTRRSQTETQGQSGN
Download sequence
Identical sequences B0DFU1
jgi|Lacbi1|328732|fgenesh3_pg.C_scaffold_18000064 29883.JGI328732 XP_001882775.1.58555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]