SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29883.JGI330428 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  29883.JGI330428
Domain Number - Region: 813-837
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00149
Family Retrovirus zinc finger-like domains 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI330428
Sequence length 1057
Comment (Laccaria bicolor)
Sequence
MSGVWYGFSIPWYHGIGMELIYHPGMGTPKLDPHKGGHCGNSSTKLASIVSPNYFALLRN
KSPTIPSPPSSPEPQYNLYPFKGSDSRSLSKPSMFGKQPCNISSRSSSSSTTSITRRLNI
VDGSKLPPGLNKPISQTIAVLTVATSPVTAEGLLTTPREITMDTSSRVEGKRKLWQPSNS
SPLSFNPLDRPPVFVAPPPNSIQFHSPPEQFRPNSEADTTFEINVTTTLQEAESTPRPSQ
YMCRGMENGYSLSPMYSLWLEYCDEGESSKSTQSRVMFYATKPSLARDEVIDRGPGSPTQ
HYMVDKTLFEQIVRTVNELQVFIQHMAGLIEERTKYFQVDPDNTLLKVLEGAETTSQLHA
TWLCLTNDKLWYIHGTIPRHADKLSLDARHRLTETNEKWEKIIPAPPWLAAPAQKTSPPI
SKFSAWTSYKAASSFTLPDELEPTAPIQKKQALTTWKNPKAVQFAPQVEALEPSQSSALM
SSGTPFKSSKGLFSQDEGSNPGPFPLSGPNQHVSLHTRINMTLIEKTMVIQTEEMQTHQM
MILPAIQEDMIHRGIMITELPITVMEAEVAEEEVHLVLLRLLRAPLGLEVVIPIDLNGTK
IVLPPYIKLEQLPTWDGNHDTAINYFWKIQQLAAMKGYLPQVLGYWLWMNLKEDSTVRMW
FAMCSQEQQEYMRSHYIAYMRGIKEGYLGRTWQMKMNATYENQSFQQVGHEREDPRKFII
RRIMYTRMLVNGDMGGPLEVFLVMQRAPVSWGSVINIDSIRLSNPPNTSSSVPSLIDEGI
LKEVYQVLLKRQRPPPPRGYPFKQNDHVNTKMGRLPPSPCKVCGIPNHWDKECPDWNVYL
ETRNRSAHFTVGQSDDEPELEEKYCTAYAVLLNNRVAEQLIEMDEPSPFSNDQDFREAVM
MSLVRQSSQYSHGHKSYKWKEVSMEEVPDKDEEKMRSMLTLKEDTHVLEDVMDDIVSTSN
NIQHTLQPHVTEIEDEDDICACSKPTVMDPRYILEGIDKSKGGEPPPTLLEPNTNERNAF
NAHGNSGESRIPEKPPDTCKDFTLPLRDIPGPPTPLK
Download sequence
Identical sequences B0DL99
jgi|Lacbi1|330428|fgenesh3_pg.C_scaffold_27000036 29883.JGI330428 XP_001884787.1.58555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]