SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29883.JGI331652 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  29883.JGI331652
Domain Number - Region: 64-86
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00174
Family Retrovirus zinc finger-like domains 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI331652
Sequence length 378
Comment (Laccaria bicolor)
Sequence
MGPGSGSIAGNDRGGAADEVTLPFFYHISSEPLPMGWEPFGIYVRADSAIIGSTPEAEER
ISSRVQRCFNCGETEHAVSDCHFRRNQELISLSRSYYQFFQGTLGLANWQRVHTAEEWRQ
SRLHWLETFEPGKIQGELLRDALGDEDGDWLRNMAQWGYPKGWFSERDPRLLVRDRIWSE
HGGYVDGELDDDESFFIHSEDGVEEVTFDASFKISHYTAAVYEEYNNDDEHDQSSETSSP
PSQNPSFSSSVKRWATYPPTYFASHLLPVYNGFMLPPIHSSQRNTQADNWHLANGSSTFW
IFDAVANTHIAYQGHIPPPPPPTSEPPPLPPLDSPPPPPPPPLSPPPPPPPHPPPPLPPS
FSSAPDDGESDMELSDSD
Download sequence
Identical sequences B0DQ50
XP_001886025.1.58555 jgi|Lacbi1|331652|fgenesh3_pg.C_scaffold_35000072 29883.JGI331652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]