SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29883.JGI332715 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29883.JGI332715
Domain Number 1 Region: 223-268
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000126
Family Retrovirus zinc finger-like domains 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI332715
Sequence length 427
Comment (Laccaria bicolor)
Sequence
MEDLFTEHGINDDQEKKKQLGRYTDQMTEFEWQAFDTFAPEIEYKEFKQALIDDYPEAKN
AGKGTLANLRKICNDHQRIDIDDIVALKSLTRGFRAEQKLLLVPPALLSRDKGKAVDGKE
CRPEDPYAILDVIEMAETIAGCAQGISSSSDTRVGVNATETWTTRGHHTHTTPVHSVKLE
DDIRELNQKVALLMDKITLSEKAQMSAFQASRQEMNKLTETLMTQHVTSAPTMRQTQPTW
RMGSDGCWYCEETGHFAMNCPHREEHIRTGKIKMSGHKMFFMLTGQPVPRGTNGKSAKMI
VEEASNKDMMAQSNMFASPGEIYTQNSGEPGIVQLGIDARVKSVYTNQIRDLRDDMLDKM
ATRIDTLLGNKVPAQVARPSAQEVDIVNNMKNILSYFEGQQGQSQEAASYVATRHSQADT
QEQQGFS
Download sequence
Identical sequences B0DTN6
XP_001887248.1.58555 29883.JGI332715 jgi|Lacbi1|332715|fgenesh3_pg.C_scaffold_43000095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]