SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29883.JGI332742 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  29883.JGI332742
Domain Number - Region: 1090-1113
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0068
Family Retrovirus zinc finger-like domains 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI332742
Sequence length 1538
Comment (Laccaria bicolor)
Sequence
MAIVRIHPKREALMHLKMDKELGVGNNAGGGTVLELTTASDLYDAGVDYGVGGGTMLEWT
YGVGGGTMLESTMVWEEVSNKMGARLNRSWELEAQPHRPTTESRAQPGDRDERQGTEKQF
RGAFVISRMRYMHNHVGPAEYLVTAHCSLMGVDPRSTHSCLLLPSTSVIHCQLTISHANY
TTAPYQWLSLSTRRIRRLEFISSSIHAISIGTVLGDRNTGTSDRHGILRLSHSLSDHYVK
QWFTKVDTVGSPIYLADKPRPILASRNFQSFKAFRTNCILFGKSHESQLFDPTPTNRLKL
NKSTRFSREAPPHVPPSSNNSGSPKSKASSSSRSSSSVMESSSTSKPSASTFPTAATVKE
AKALDQRMGMERGYSLSPMYNLIIEYNKENGGNLSTAAEVSWILQNPNLHPNHFERKTGD
GVDPYTCVTLQPAKLNRILRAVTELQIFLDQMVQLIEEREKAFCIDPEDTMVTTLRGGES
RSQLVVAYSILSKRLRIAQQTVMKYEAEYRHAEVPLSPISTVPELYEDFARLDLVNDRMK
YMLQNIPHHQNQLTAESLDALNQGQSWDVVHPTMPIQSLDAPPPPTELEGQPRIQPSQPE
PHEEDKDEWPTTSQWDDLEMLPGQGRNEAEGVESSFGFQTPFRTGKTFFDVSNVSQPTSY
FSTPGFNTTPDVTRGLPTPSRTQLGDNVRQEANVSTASKTVTVATKTTQVNSNPFNHSSG
PSSSSNAPNNGPPNERPSPGGVPPSGGSPGGGPGNGGGGGPPGGGGGGSPPNNRGSGPPY
GGGPNSHGHNGGNPGGNPGGNPGGNDPPNPPGGNAPGPPTPYRMFPANIKAELKIEQLPE
WDGNHWTAINYFWQVQQLAFLGGWLPEALGYWLWFRLKEGSGVRNWFVTLPMMHQSFMCS
HYLKFLKGIKDGYLGTKWQLKMNNYYNNQTFRERNHKRESPAEFITRRIVYTRMLDTSEL
YSRVTEHEEALLESYRVSKGRAPQSIDNIAMQLKQLGFVQQKPPYQEKSPYHEKPAYQEK
PPYQRRANLAENPDTTSSSMPEVADTITTNFDADKHILREAYQVLQQRQRPPPKGGYPFS
KNDHVTTKMGKLPPSPCKCCGSKNHWDKECPDWNIYLERANRSVNVGESTPMENEAETTY
RTAYSILLNQRLGGEVVNQSHLEESLQQQDFKAASLLSEVTKPKSSTHVLEEINDAEASA
HTATTQERVPPNFRSPPTTDSGTEDPTKSLPDPPVVEARVKLKKRRYTPAGASAVGVSVV
ATQGWVGSTRNPIVDLRMDSCADVTLISQEYYESLKDRPPIQKGFKMNLWQLTDKDSKIQ
GYVRLPVFMRSIEGTIVETEAEAYIVPNMTVPILLGEDYHLNYELLVAHKVDFCSMIGFA
GALYSVQARGVARTRDFDRLRQSAYADRSFIKAKLHKRNKAKKARKRKSAGIEQRTIRAA
EDYRLKPDECRRIRVDGHFEEDREWLVEKNLLADSNDSAFVVPNVLISSTDPWIPISNPS
SHPRTIRRGDIVGYLVDPQEHFDVPVTEHFSHPLTTDY
Download sequence
Identical sequences B0DTY0
jgi|Lacbi1|332742|fgenesh3_pg.C_scaffold_44000023 XP_001887318.1.58555 29883.JGI332742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]