SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29883.JGI333842 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  29883.JGI333842
Domain Number - Region: 114-136
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00152
Family Retrovirus zinc finger-like domains 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI333842
Sequence length 510
Comment (Laccaria bicolor)
Sequence
MTDVVVVCVVVAVGDVAVSRGWEQPRTRPPLLSTPMRATQDRPPQHRRVLMTIAEEREGN
QVTEEVPKQEESQIDETHDDMLREVYQVMQKRQRAPPPGGYMFPRNDHVTTKMGKLPPSP
CRACGSENHWDKECPDGEIYNARMASEHRNGHSNETVEDEGDKCYQSAFSILLSQRLATS
QFDLSRVKSDFEQAVHHEEINALSVEDRVDERKSVERQRVTVQEIDDESWLEARSKPKAS
TYLLYNTNEETEDERPDRTKDPPPSARNSESLHENATANGPDQAPTLSDDKIRSATAAAA
LASESKEQTLPRNDSPDDVESPSDFQLPPPPKDLKPVRLAKKRFYPVGESSVGVSVLSVK
GWVGNMSNPITDLRLDSCADVTLISAEYYDSLKASPPIQQGMCMRLWQLTDKDSRLRGFV
RIPILMVTDDGITIKSEAEAYVVPGMTVPILLGEDYQLTYEVGVTRNVEEGPQVHFGKSE
YSVTAKQVERTKDFDRMRQSAHSIGRFIRN
Download sequence
Identical sequences B0DX93
jgi|Lacbi1|333842|fgenesh3_pg.C_scaffold_56000029 29883.JGI333842 XP_001888544.1.58555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]