SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29883.JGI334420 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29883.JGI334420
Domain Number 1 Region: 248-277
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000481
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 
Weak hits

Sequence:  29883.JGI334420
Domain Number - Region: 292-392
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00659
Family alpha-catenin/vinculin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI334420
Sequence length 416
Comment (Laccaria bicolor)
Sequence
MPDPSSSSIEEPAPTDQMEDLFAEYGINSDVEKKKKLGKYTDQRTEFEWKAFKTFEDSSF
DKFKKALIADYPDARNAGKGTLTGLRAGTTKITHGAASTGCLTDSFADQVKASLNIEQTR
DRKQKGNEDETTARRTEDPYDIIDIIDMAETIAGRLTGDSQDHPSNARAVLTGRSVQARE
REIKTEHDEFEELRSITATFLDQIKVDQKQNSELRNMVQNMQIEMKKLLETLVHQQPNIS
NPQSKVASYKMTSDGCWYCDEPGHFTSNCPHREAHVAQKKIKLLGNRMYFTHNNTAVPRG
NGEKSVRQIVEEASRQNLTLQNNMFAEPGEVFSQEAVVPGIIRLPDNNNGNEISVFTNQM
RDTRDDVILNMNNQVLKLTDMLANLVTNPNKTRDVDASQFAVTCRSQTETQGQSGN
Download sequence
Identical sequences B0DZ59
jgi|Lacbi1|334420|fgenesh3_pg.C_scaffold_63000058 29883.JGI334420 XP_001889235.1.58555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]