SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 29883.JGI335154 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  29883.JGI335154
Domain Number 1 Region: 299-343
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000167
Family Retrovirus zinc finger-like domains 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 29883.JGI335154
Sequence length 503
Comment (Laccaria bicolor)
Sequence
MPDNNQDEAPATGGRRSSRPMSLPGSQGASNFDKEKPIELLRFIDQMEDLFTEHGIDDDQ
EKKKQLERYTDQMTEFEWRAFDTFAPEVEYKEFKQALIDDYPEAKNAGKGTLANLRKNCN
DHQRIDIDDIVALKSLTRGFRAEQKLLLVPPALVSNRELVELFLGCLRDSFRGQVEGSLN
IKFSKDDKGKTAEGKERRPEDPYAILDVIEMAETIAGRAQGISSSSDTQVGVNATETRTT
QEHHTHTTPVHSVKLEDDIRELNQKVALLMDKITLSEKAQMSAFQASRQEMNKLTETLMT
QHVTSAPTMRQTQPTWRMGSDGCWYCEETGHFAMNCPHREEHIRMGKIKMFGHKMFFALT
GQPVPRGTNGKSAKMIVEEASNKEMMAQSNMFALPGDIYTQNSGEPGIVQLGIDARVKSV
YTNQIRDSRDDMLDKMATRIDTLLGNKVLAQVARPLAQEVDIVNNMKNILSYFEGQQGQG
QEAASYVATRHSQADTQRQQGFL
Download sequence
Identical sequences B0E1J1
29883.JGI335154 jgi|Lacbi1|335154|fgenesh3_pg.C_scaffold_78000003 XP_001890084.1.58555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]